PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G22030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 374aa    MW: 40355.5 Da    PI: 7.2026
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G22030.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.9e-53381641128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +k+++    +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkd+e+++
  OGLUM02G22030.2  38 LPPGFRFHPTDEELITHYLLRKAADPAGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFR 131
                      79*********************9999666689***************988899**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grap+g kt Wvmheyr+
  OGLUM02G22030.2 132 -GKALVGMKKTLVFYTGRAPRGGKTGWVMHEYRI 164
                      .99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6526187IPR003441NAC domain
PROSITE profilePS5100559.69338187IPR003441NAC domain
PfamPF023652.9E-2939164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MRLARQQQQQ VVVAATMEHD VHHHRQMMQQ QQQQEMDLPP GFRFHPTDEE LITHYLLRKA  60
ADPAGFAARA VGEADLNKCE PWDLPSRATM GEKEWYFFCV KDRKYPTGLR TNRATESGYW  120
KATGKDREIF RGKALVGMKK TLVFYTGRAP RGGKTGWVMH EYRIHGKHAA ANSKQDQEWV  180
LCRVFKKSLE LAAAAAAAGR RGAGAGTDVG PSSMPMADDV VGLAPCALPP LMDVSGGGGG  240
AGTASLSATA GAAAAPPPAH VTCFSNALEG QFLDTPYLLP AADPADHLAM SSASPFLEAL  300
QMQYVQDAAA AGGAGMVHEL LMGGGWYCNK GERERLSGAS QDTGLTSSEV NPGEISSSSR  360
QQRMDHHDAS LWAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-55241873165NO APICAL MERISTEM PROTEIN
1ut4_B1e-55241873165NO APICAL MERISTEM PROTEIN
1ut7_A1e-55241873165NO APICAL MERISTEM PROTEIN
1ut7_B1e-55241873165NO APICAL MERISTEM PROTEIN
4dul_A1e-55241873165NAC domain-containing protein 19
4dul_B1e-55241873165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281800.0AB028180.1 Oryza sativa mRNA for OsNAC1 protein, complete cds.
GenBankCT8347650.0CT834765.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA021O03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623389.10.0PREDICTED: NAC domain-containing protein 92 isoform X1
SwissprotQ9FLJ26e-90NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D9YU290.0A0A0D9YU29_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g36880.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.14e-85NAC domain containing protein 100